Protein Info for Ac3H11_2428 in Acidovorax sp. GW101-3H11

Annotation: Uracil phosphoribosyltransferase (EC 2.4.2.9)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01091: uracil phosphoribosyltransferase
  • amino acids 4 to 209 (206 residues), 282.3 bits, E=1.2e-88
• PF14681: UPRTase
  • amino acids 6 to 208 (203 residues), 262.5 bits, E=2.3e-82
• PF00156: Pribosyltran
  • amino acids 67 to 168 (102 residues), 39.8 bits, E=2.8e-14

Best Hits

Swiss-Prot: 95% identical to UPP_ACIET: Uracil phosphoribosyltransferase (upp) from Acidovorax ebreus (strain TPSY)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 92% identity to aaa:Acav_2048)

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• pyrimidine nucleobases salvage II (2/2 steps found)
• pyrimidine nucleobases salvage I (1/1 steps found)
• superpathway of pyrimidine ribonucleosides salvage (6/10 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.9

Use Curated BLAST to search for 2.4.2.9

Sequence Analysis Tools

See A0A165KU32 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Ac3H11_2428 Uracil phosphoribosyltransferase (EC 2.4.2.9) (Acidovorax sp. GW101-3H11)
MSNVTVITHPLVQHKLTLMRKKDASTNSFRRLLGELSTLMAYEVTRDMPLQDVQIETPLE
TMTGKVIDGKKLVLVSILRAGNGFLDGMLNVVPGARVGHIGLYRDPATLQPVEYYFKMPS
EMDERDIIVVDPMLATGNSAAACVDRLKKLNPRSIKFVCLLAAPEGVATLQKAHPDVPIF
TAAIDRELNDHGYILPGLGDAGDRIFGTK