Protein Info for Ac3H11_2375 in Acidovorax sp. GW101-3H11

Annotation: Glutathione S-transferase (EC 2.5.1.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 4 to 77 (74 residues), 30.8 bits, E=7.8e-11
• PF13409: GST_N_2
  • amino acids 14 to 78 (65 residues), 39.8 bits, E=1.4e-13
• PF00043: GST_C
  • amino acids 107 to 192 (86 residues), 38.1 bits, E=3.9e-13
• PF14497: GST_C_3
  • amino acids 110 to 196 (87 residues), 28.3 bits, E=4.2e-10
• PF13410: GST_C_2
  • amino acids 127 to 197 (71 residues), 38.1 bits, E=3.3e-13

Best Hits

Swiss-Prot: 50% identical to GSTA_ECO57: Glutathione S-transferase GstA (gstA) from Escherichia coli O157:H7

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 61% identity to aav:Aave_2574)

MetaCyc: 50% identical to glutathione S-transferase GstA (Escherichia coli K-12 substr. MG1655)
Glutathione transferase. [EC: 2.5.1.18]

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (4/10 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

See A0A162DM01 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Ac3H11_2375 Glutathione S-transferase (EC 2.5.1.18) (Acidovorax sp. GW101-3H11)
MQTSIKLYYAPGACSLATHILLRETGTPFTLEKVDTSKHTTSGGDFYAISPKGQVPVIEL
PDGTRITEGPVVAQYVADRAGAHTLMPPAGSLERYRVMEWQNYVTAELHKSFTPLFHSDV
DATAKKALAAVLYKKLVWLDGQLAGKSYLTGDDFTAADAYLFVVLGWAKFVQIDLVELQH
IGSFMARVAARPEVRAAMQAEGLVG