Protein Info for Ac3H11_2293 in Acidovorax sp. GW101-3H11

Annotation: Electron transport complex protein RnfB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 16 to 168 (153 residues), 193.1 bits, see alignment E=1.8e-61 PF04060: FeS" amino acids 25 to 57 (33 residues), 52.4 bits, see alignment 1.4e-17 PF14697: Fer4_21" amino acids 90 to 144 (55 residues), 67.1 bits, see alignment E=4.7e-22 PF00037: Fer4" amino acids 91 to 112 (22 residues), 30.6 bits, see alignment (E = 8.4e-11) amino acids 122 to 143 (22 residues), 21.7 bits, see alignment (E = 5.4e-08) PF13237: Fer4_10" amino acids 92 to 138 (47 residues), 26 bits, see alignment 3.1e-09 PF13187: Fer4_9" amino acids 97 to 142 (46 residues), 30.2 bits, see alignment 1.5e-10 PF12838: Fer4_7" amino acids 97 to 141 (45 residues), 30.1 bits, see alignment 2.2e-10

Best Hits

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 68% identity to vei:Veis_0273)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KRR3 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Ac3H11_2293 Electron transport complex protein RnfB (Acidovorax sp. GW101-3H11)
LIRQPEAPPACAAPTDLAARIDAALPQTQCTRCGYPDCATYAQAIASGEAAINQCPPGGA
EGVARLAAITGLAVLPLSTEHGVEGPRTVAFIDEAWCIGCTLCIKACPTDAIVGSNKRMH
TVIEPYCTGCELCIPVCPVDCIQLETASGMATGWAAWSAPLAEQARARYQQHRQRMPLED
AEEEPAAAMGEPAQDSASTPTSAADARKAAIAAAMERARQRREQNPH