Protein Info for Ac3H11_2272 in Acidovorax sp. GW101-3H11

Annotation: Biotin synthase (EC 2.8.1.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR00433: biotin synthase" amino acids 46 to 341 (296 residues), 394 bits, see alignment E=2.1e-122 PF04055: Radical_SAM" amino acids 80 to 227 (148 residues), 78.7 bits, see alignment E=5.9e-26 PF06968: BATS" amino acids 251 to 342 (92 residues), 100 bits, see alignment E=6.9e-33

Best Hits

Swiss-Prot: 82% identical to BIOB_ACIAC: Biotin synthase (bioB) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 82% identity to aav:Aave_2518)

MetaCyc: 60% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KRD9 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Ac3H11_2272 Biotin synthase (EC 2.8.1.6) (Acidovorax sp. GW101-3H11)
MSATLAPTAASTVQPAPSSVQPVQLHRRTPAPAAQGPWSVEAIQALLDKPLMDLLFEAQT
VHRQHWPAGDIELATLLSVKTGGCPENCGYCPQAAEFDTGVKAEKLMEVDEVVRAAQAAK
DAGATRFCMGAAWRAPKDRDIEKVSALIGAVKGLGLQTCATLGMLESHQAQALKDAGLDY
YNHNLDTAPEYYTDVVSTRAYQDRLDTLQNVRSAGISVCCGGIVGMGEAPVHRAGLIAQL
ANLQPYPESVPINSLVRVPGTPLADSDPIDPFDFVRVIAVARITMPKARVRLSAGRQQMG
EAVQALCFMAGANSIFYGDKLLVTGNPDVDADVQLLAKLGLNGHRTTTTEAEHAHHHA