Protein Info for Ac3H11_2232 in Acidovorax sp. GW101-3H11

Annotation: Zinc-regulated outer membrane receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 737 transmembrane" amino acids 47 to 63 (17 residues), see Phobius details PF07715: Plug" amino acids 97 to 201 (105 residues), 69.9 bits, see alignment E=2.6e-23 PF00593: TonB_dep_Rec" amino acids 358 to 706 (349 residues), 128.9 bits, see alignment E=5e-41

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 75% identity to ajs:Ajs_2033)

Predicted SEED Role

"Zinc-regulated outer membrane receptor" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165L542 at UniProt or InterPro

Protein Sequence (737 amino acids)

>Ac3H11_2232 Zinc-regulated outer membrane receptor (Acidovorax sp. GW101-3H11)
VKLSACPHTPGPPGVAQRMPLLQATTMTSTSFAHPTMPQRRRPTTLHPVALAAMLALSGA
GSIAQAQTPAPAAAEATPSLPPVTVTVSASGLQLGASDMTTPATVLEGDELVRRREATLG
ETLNSEPGITSSHFGAGASRPIIRGMDGPRVKVLSDGAELHDASTISPDHAVVSEPMLAT
QIEVLRGPSALIYGNGAVGGVVNVLDGKVPTAVPAKGLEGSAELRANTGAREGAGAFSLT
GGTGNLAVHVEGVARDAGDYRVGKGWAPEGEATRKVLGSFNRTNTGSVGLSWVGDRGYLG
AAYTRQAAKYGLPGHNHSFEGCHTHGNQLHCGAHEGEEGEDGHDHDHGAGHGDVPVVDLR
SERFDIRGELRNPFAGFSALRLRAGVTDYVHDEVEDGAISTTFKNKAYDTRIELQHEPIA
GFKGVIGLQTSQRKFSAEGEEAYVQPTVTRRTGLFALEEYRLGDWRFEAALRHDRQTTHA
ETSGIERSHNGTSASLGAVWKFTPGYQVGASFTRASRAPSAEELYARGLHMATSTYERGD
ASLRSETSQNFDLSLKKTAGDTTFGVSVFRNSIHNYIYGRTLDALDGLQLLQYSQADATF
TGIEGQVRQRLNRNLGVTLFGDTVRARIDGAGNLPRIPATRAGLRLDGNWNAWEGQVEWV
QVARQNRIAAFETATPGYGMLNVGLAYNGQFSSGTPWQVYLKGTNLTDRLAYAHTSFIKN
AAPLMGRNLTVGVKVAF