Protein Info for Ac3H11_2221 in Acidovorax sp. GW101-3H11

Annotation: Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF01135: PCMT" amino acids 21 to 204 (184 residues), 107.5 bits, see alignment E=5e-34 PF00398: RrnaAD" amino acids 84 to 150 (67 residues), 38 bits, see alignment E=6.3e-13 PF05175: MTS" amino acids 90 to 169 (80 residues), 34.1 bits, see alignment E=1.3e-11 PF01209: Ubie_methyltran" amino acids 94 to 185 (92 residues), 23.7 bits, see alignment E=1.7e-08 PF02475: Met_10" amino acids 95 to 149 (55 residues), 21.2 bits, see alignment E=1.3e-07 PF13489: Methyltransf_23" amino acids 97 to 189 (93 residues), 32.4 bits, see alignment E=4.5e-11 PF13847: Methyltransf_31" amino acids 99 to 179 (81 residues), 37.6 bits, see alignment E=1.1e-12 PF13649: Methyltransf_25" amino acids 102 to 178 (77 residues), 48.6 bits, see alignment E=6.6e-16 PF08241: Methyltransf_11" amino acids 103 to 178 (76 residues), 43.1 bits, see alignment E=3.3e-14 PF08242: Methyltransf_12" amino acids 103 to 186 (84 residues), 32.5 bits, see alignment E=7e-11

Best Hits

Swiss-Prot: 34% identical to PIMT_DESAD: Protein-L-isoaspartate O-methyltransferase (pcm) from Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 78% identity to vei:Veis_2350)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168F759 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Ac3H11_2221 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (Acidovorax sp. GW101-3H11)
MNMPLNTSANISDPVAQARYNMIEQQIRPWNVLDFDVLELLAVVRREDFVPPAYRSMAFM
DIEVPLLGSDAEEAVRRGHSMLQPRVEARILQDLQVKATDRVLEIGAGSGYMAALLAHRA
ERVVSLEINPELAEMARENLRDAGIQNADVRQGDGARDAIPDGPFDVIVLSGSVAEVPAA
LLALLKDGGRLGAIVGGEPVMRFTLTRRTGDRFETTAPWDTIAPRLVNFPEPSGFTF