Protein Info for Ac3H11_2150 in Acidovorax sp. GW101-3H11

Annotation: Dienelactone hydrolase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF01738: DLH" amino acids 15 to 227 (213 residues), 164.5 bits, see alignment E=1.4e-52

Best Hits

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 80% identity to ajs:Ajs_0260)

Predicted SEED Role

"Dienelactone hydrolase family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.45

Use Curated BLAST to search for 3.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168F5D4 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Ac3H11_2150 Dienelactone hydrolase family (Acidovorax sp. GW101-3H11)
MGQFVDLTSGDGFVFPAWVAQPDAAPRGAVVVLQEIFGVNSHIRAVADRFAARGYLAVAP
STFHRVKPGVELGYTGDDMQAGMGLKAAVEALPAPGVMPDIQAAIDYAAAQSGRKVGIVG
FCWGGLLTWRAACTLNGLSAAVPYYGGGMTSPDEAARQPRVPVLAHFGERDHWIPVDSVQ
AFARAQPGAEVHIYAADHGFNCDQRGSYDEPAAMTARDRTLAFFDKHLA