Protein Info for Ac3H11_2146 in Acidovorax sp. GW101-3H11

Annotation: Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03653: UPF0093
  • amino acids 2 to 145 (144 residues), 142.5 bits, E=6.4e-46

Best Hits

KEGG orthology group: K08973, putative membrane protein (inferred from 85% identity to dia:Dtpsy_0263)

Predicted SEED Role

"Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Biosynthesis of alkaloids derived from shikimate pathway
• Limonene and pinene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.-.-

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

See A0A168F5B2 at UniProt or InterPro

Protein Sequence (145 amino acids)

>Ac3H11_2146 Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-) (Acidovorax sp. GW101-3H11)
MLWVKAFHIVFVASWFAGLFYLPRIFVNLAMVAPGSVAERDRLLLMARKLLRFTTLLAVP
ALALGVWLWMGYGIGRGPASQGNGWMHAKLAVVVLVIGYHHACAVLLRKLADGTCRKSHV
WFRWFNEAPVLLLLLAVVLVVVKPF