Protein Info for Ac3H11_2122 in Acidovorax sp. GW101-3H11

Annotation: Ni,Fe-hydrogenase I cytochrome b subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 125 to 141 (17 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 9 to 182 (174 residues), 77.8 bits, see alignment E=4.6e-26

Best Hits

KEGG orthology group: None (inferred from 73% identity to vei:Veis_1276)

Predicted SEED Role

"Ni,Fe-hydrogenase I cytochrome b subunit" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168F461 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Ac3H11_2122 Ni,Fe-hydrogenase I cytochrome b subunit (Acidovorax sp. GW101-3H11)
MTPHTVRIWDLPTRLFHWALAACVVGLVITAKVGGNAMEWHFRLGYAVLALLVFRVVWGL
IGGRWSRFSAFLYSPARLVRYLRGNAHPEDNAGHSPLGALSVLALLAVLGAQVGTGLLSD
DEIAFAGPLTRFVSNAVVGQATGYHKEIGQYLVLGLVALHVLAVLFYVVVRKHTLVRPML
GGDKALPTPAAPSRDDALSRALALVVLAGSASLAWWVSSLAMAAGF