Protein Info for Ac3H11_2106 in Acidovorax sp. GW101-3H11

Annotation: Membrane bound c-di-GMP receptor LapD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 150 to 169 (20 residues), see Phobius details PF16448: LapD_MoxY_N" amino acids 24 to 144 (121 residues), 148.9 bits, see alignment E=1.3e-47 PF00672: HAMP" amino acids 168 to 217 (50 residues), 30.6 bits, see alignment 7.2e-11 PF00990: GGDEF" amino acids 235 to 386 (152 residues), 64.2 bits, see alignment E=2.5e-21 PF00563: EAL" amino acids 411 to 633 (223 residues), 149.2 bits, see alignment E=2.8e-47

Best Hits

KEGG orthology group: None (inferred from 70% identity to pol:Bpro_0308)

Predicted SEED Role

"Membrane bound c-di-GMP receptor LapD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168F3S6 at UniProt or InterPro

Protein Sequence (637 amino acids)

>Ac3H11_2106 Membrane bound c-di-GMP receptor LapD (Acidovorax sp. GW101-3H11)
MSLTKQLWLAIGLVMALAFGGSMLVSVLSARHYLQQQLQVKNIDNATSLALALSQLDKDP
VTVELQVAAQFDAGHYRFIRIVSPTGQTLVERSFSGSLQGAPAWFARLIPMNAEPGRAQI
QDGWKQYGTLTLASHDQYAYQSLWTGTLELLAWFVLGSVVAGGVGTLAIKRITKPLRDVV
AQAEAIADRRFIKIAEPRTPELRSVARGMNDMVTRLRSMFGEEAARLDGLRKKVNRDAVT
GLSSRDYFLSHLQEALEGEQFLSAGSLVILRLTDLEGLNTQLGHQKADALLKHLGTVLYK
SGEGKPGQRAGRLKGGEFGVLCPSTPSPQEAAQDIFASLSAQWLPHWSALVPDLFHIGAV
GYRRQEPLGELFSRADEALARAASLGPNSMYVDEGAHSADARPAEQWRTLLTEAVSGGRL
QLAFYPVVDGSGDGAIHQEGVIRLVADASGALLSAGDFMPMAAHLNLTAPIDLRVVRLAI
EHLRSSAGDIAVNLSAETIADFRFRNELTQLLHTYPDMCTRLLFEVPEYGVFRAFDAFKE
LAHTLQQLGCRVGIEYFGQRFTEGNKLADLGLDYIKVHPSYVRGIGDNLGNQEFLRGLCN
IAHAIGIQVIALGVESRDDLPLLASLGFDGATGPGIR