Protein Info for Ac3H11_2103 in Acidovorax sp. GW101-3H11

Annotation: Lipoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF16881: LIAS_N" amino acids 32 to 79 (48 residues), 30.1 bits, see alignment 5.5e-11 TIGR00510: lipoyl synthase" amino acids 35 to 320 (286 residues), 429.6 bits, see alignment E=3.2e-133 PF04055: Radical_SAM" amino acids 94 to 257 (164 residues), 91.5 bits, see alignment E=7e-30

Best Hits

Swiss-Prot: 96% identical to LIPA_ACIAC: Lipoyl synthase (lipA) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 96% identity to aaa:Acav_0432)

MetaCyc: 62% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168F3Q9 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Ac3H11_2103 Lipoate synthase (Acidovorax sp. GW101-3H11)
MSTPEVVREAQSTEAYNPLAKQKAAAKLSRIPIKVEQGEVLKKPDWIRVKAGSPTTRFYE
IKEILREHKLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDKD
EPLNLAKTIAALKLKYVVITSVDRDDLRDGGSGHFVECIQNIRELSPTTQIEILVPDFRG
RDDRALEILKAAPPDVMNHNLETAPRLYKEARPGSDYQFSLNLLKKFKALHPNVPTKSGI
MVGLGETDEEILQVMRDMREHNIDMLTIGQYLSPSNSHLPVRRYVHPDTFKMFEEEAYKM
GFSHAAVGAMVRSSYHADQQAHAAGV