Protein Info for Ac3H11_2092 in Acidovorax sp. GW101-3H11

Annotation: ATP synthase epsilon chain (EC 3.6.3.14)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 TIGR01216: ATP synthase F1, epsilon subunit" amino acids 3 to 131 (129 residues), 136.8 bits, see alignment E=2.1e-44 PF02823: ATP-synt_DE_N" amino acids 4 to 83 (80 residues), 102.7 bits, see alignment E=8.6e-34 PF00401: ATP-synt_DE" amino acids 87 to 130 (44 residues), 28.8 bits, see alignment E=1.1e-10

Best Hits

Swiss-Prot: 93% identical to ATPE_VEREI: ATP synthase epsilon chain (atpC) from Verminephrobacter eiseniae (strain EF01-2)

KEGG orthology group: K02114, F-type H+-transporting ATPase subunit epsilon [EC: 3.6.3.14] (inferred from 91% identity to aav:Aave_0373)

MetaCyc: 53% identical to ATP synthase F1 complex subunit epsilon (Escherichia coli K-12 substr. MG1655)
ATPSYN-RXN [EC: 7.1.2.2]; RXN0-7041 [EC: 7.1.2.2]

Predicted SEED Role

"ATP synthase epsilon chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14 or 7.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165L4K6 at UniProt or InterPro

Protein Sequence (138 amino acids)

>Ac3H11_2092 ATP synthase epsilon chain (EC 3.6.3.14) (Acidovorax sp. GW101-3H11)
MNTIHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITRIKPGSVRIEMANGDEE
FVFVAGGILEVQPNCVTVLSDTAIRGKDLDDEKANAAKASAEEALKNAKSELDLAKAQSE
LAVMAAQIAALRKFRQKK