Protein Info for Ac3H11_2079 in Acidovorax sp. GW101-3H11

Annotation: Membrane protein TerC, possibly involved in tellurium resistance

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 126 to 152 (27 residues), see Phobius details amino acids 164 to 180 (17 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details TIGR03717: integral membrane protein, YjbE family" amino acids 13 to 186 (174 residues), 227.9 bits, see alignment E=3.6e-72 PF03741: TerC" amino acids 15 to 184 (170 residues), 168 bits, see alignment E=9.3e-54

Best Hits

Swiss-Prot: 43% identical to YJBE_BACSU: Uncharacterized membrane protein YjbE (yjbE) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 82% identity to aaa:Acav_4621)

Predicted SEED Role

"Membrane protein TerC, possibly involved in tellurium resistance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KQF3 at UniProt or InterPro

Protein Sequence (228 amino acids)

>Ac3H11_2079 Membrane protein TerC, possibly involved in tellurium resistance (Acidovorax sp. GW101-3H11)
MELVQSADFWIGLVKIVWINIILSGDNAVVIALAARSLPPHQQRKAVFWGSGAAVVLRIA
LTVVAAKLLQLSFLQILGGCLLLWIGFQLLSGDEESEGESKTYGSLMAAVRTILIADLVM
SLDNVIAVAAAAQGSVVLLVLGLAISIPLVIFGSTLMIKLMERFPVIVLLGAALIGWVGG
ETIASDAALHDYAVAHPALHYVAAALGAALVVGVGKFWPFRAARNSAA