Protein Info for Ac3H11_207 in Acidovorax sp. GW101-3H11

Annotation: FIG137360: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF03618: Kinase-PPPase" amino acids 22 to 279 (258 residues), 283.1 bits, see alignment E=1.3e-88

Best Hits

Swiss-Prot: 89% identical to PSRP_VEREI: Putative phosphoenolpyruvate synthase regulatory protein (Veis_2049) from Verminephrobacter eiseniae (strain EF01-2)

KEGG orthology group: K09773, hypothetical protein (inferred from 89% identity to vei:Veis_2049)

Predicted SEED Role

"FIG137360: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JNQ2 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Ac3H11_207 FIG137360: hypothetical protein (Acidovorax sp. GW101-3H11)
VVATPLAQAASKKRASMHSRTVFFVSDGTGITAETFGNAILAQFEMKPRHVRLPFIDTVD
KAHQAVRQINHTGEVEGKKPVVFTTLVNMEVLKVIQEGCKGMLLDMFGTFVHPLEEELGI
KSHHRVGRFSDVSRSKEYTDRIEAINFSLAHDDGQSNRDLAGADVILVGVSRSGKTPTSL
YLAMQCGLKAANYPLIPEDFERRQLPPALVPFRNKIFGLTISPDRLAEIRAERRPNSRYA
SLENCRMEVSEAEAMMRRAGIRWLSTTTKSIEEIATTILQEIRPEKLVY