Protein Info for Ac3H11_2052 in Acidovorax sp. GW101-3H11

Annotation: Putative glutathione transporter, ATP-binding component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF00005: ABC_tran" amino acids 52 to 205 (154 residues), 123.9 bits, see alignment E=8e-40 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 255 to 338 (84 residues), 90.3 bits, see alignment E=3.4e-30 PF08352: oligo_HPY" amino acids 256 to 320 (65 residues), 73.6 bits, see alignment E=1.3e-24

Best Hits

Swiss-Prot: 52% identical to APPF_BACSU: Oligopeptide transport ATP-binding protein AppF (appF) from Bacillus subtilis (strain 168)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 91% identity to aaa:Acav_0891)

Predicted SEED Role

"Putative glutathione transporter, ATP-binding component" in subsystem Utilization of glutathione as a sulphur source

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KPL7 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Ac3H11_2052 Putative glutathione transporter, ATP-binding component (Acidovorax sp. GW101-3H11)
MSAATTTTAASAPVKSKALVQAHDLAKTFDVSAPWLNRVIERKPRTLLHAVDGVSFEIEK
GKTLALVGESGCGKSTVARLLVGLYEPTRGGLTFDNQDAHAAFKGKDAQAMRRRIQMIFQ
DPYASLNPRWLVEDIIGEPLREHGLITDKAELKARVGELLKSVGLSPLDMVKYPHQFSGG
QRQRISIARALATEPEFLVCDEPTSALDVSVQAQVLNIMKDLQRERQLTYLFISHNLAVV
RHVSDQVGVMYLGRLVELADKHQLFNSPRHPYTRMLLDAIPKMHDTGKARTPVQGEVPNP
LNPPPGCAFNPRCPHVNDRCRTERPKLLSIGGIRIACHAVEEGRI