Protein Info for Ac3H11_2050 in Acidovorax sp. GW101-3H11

Annotation: Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details amino acids 131 to 155 (25 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 218 to 243 (26 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details PF12911: OppC_N" amino acids 13 to 63 (51 residues), 29.1 bits, see alignment 7e-11 PF00528: BPD_transp_1" amino acids 110 to 303 (194 residues), 114.5 bits, see alignment E=5.2e-37

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 92% identity to aaa:Acav_0889)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KPK1 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Ac3H11_2050 Dipeptide transport system permease protein DppC (TC 3.A.1.5.2) (Acidovorax sp. GW101-3H11)
MKTTLARWFDSDVGYSFRTSPMAMVAAAIALICVFCSVFAGWVAPHNPFDLATLELSDAR
LPPAWSAEGSMKYPLGTDDQGRDILSALIYGARISLVVGLASVVLSVLVGVAFGLLAGFK
GGWIDAVLMRLCDVMLSFPAILVALLIAGVGRALFPNAHESLAFGVLIISISLTGWVQYA
RTVRGSTLVERNKEYVQAARVTGVSPLRIMRKHVLPNVMGPVMVLATIQVATAIITEATL
SFLGVGAPPTSPSLGTLIRIGNDYLFSGEWWITVFPGAMLVLIALSVNLLGDWLRDALNP
RLR