Protein Info for Ac3H11_2019 in Acidovorax sp. GW101-3H11

Annotation: Cell division protein FtsQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details PF08478: POTRA_1" amino acids 43 to 112 (70 residues), 54.2 bits, see alignment E=1.5e-18 PF03799: FtsQ_DivIB_C" amino acids 116 to 239 (124 residues), 68.9 bits, see alignment E=7.2e-23

Best Hits

KEGG orthology group: K03589, cell division protein FtsQ (inferred from 74% identity to vei:Veis_4573)

Predicted SEED Role

"Cell division protein FtsQ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KNZ3 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Ac3H11_2019 Cell division protein FtsQ (Acidovorax sp. GW101-3H11)
MTHALPAPLDVKLMNLTASVLFVGCALAVLAAGVGWVLRYPGFAIARIVVQGELVHNNAV
TLRANVGPHLVGNFFTVDLRAAREAFEQVPWVRSAEVRRVYPASLRVELQEHDAVAFWGP
ESGSAMVNSHGEVFEANVGDVELEGLPRLLGPQGSSAEALKMVGLLQPVFEPLGLEVEEL
ELTGRGGWRARLDSDAVVELGGGTPEEVVRRTQRFVRTLTQVAAQYGRRVDALESADLRH
AGGYALRLRGVTTVIPDAAGAVAGATGGVRRR