Protein Info for Ac3H11_2 in Acidovorax sp. GW101-3H11

Annotation: Macrophage infectivity potentiator-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 TIGR01926: uncharacterized peroxidase-related enzyme" amino acids 23 to 190 (168 residues), 88.2 bits, see alignment E=5.6e-29 PF02627: CMD" amino acids 70 to 138 (69 residues), 31.5 bits, see alignment E=6.9e-12 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 78 to 124 (47 residues), 48.1 bits, see alignment 6.4e-17

Best Hits

KEGG orthology group: None (inferred from 80% identity to vpe:Varpa_4109)

Predicted SEED Role

"Macrophage infectivity potentiator-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165I0I0 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Ac3H11_2 Macrophage infectivity potentiator-related protein (Acidovorax sp. GW101-3H11)
VPDLQRFTTCKEITMSDHSSTARVALVDRTAASGPARALLDQIHGAFGTTPNMFRAVANS
PAALQSMWAAFGALGGGVVDAALGEQIAVAVANRNACDYCLAAHTALGRKAGVSGDALAA
AQSGESADPHTAAVLRFALQLVNQRGQVDAADVQALRDQGLSDEHIVEVVAHVALNLFTN
YVNVALAVPVDFPGVKLRPAR