Protein Info for Ac3H11_1939 in Acidovorax sp. GW101-3H11

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 39 to 56 (18 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 167 to 182 (16 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 226 to 250 (25 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 7 to 276 (270 residues), 111.2 bits, see alignment E=2.5e-36

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 84% identity to rfr:Rfer_3499)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KLZ7 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Ac3H11_1939 High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1) (Acidovorax sp. GW101-3H11)
VQFVQLLISGVSQGCIYGLIALGFVLIYKATETVSFAQGELMMLGAFCGLALMTVLGFPF
WVAVLASVVAMGLFGVLVERAVIRPILGQPAFSIVMLTIGIGYVLRGLVTMIPNIGTDTH
TLPVPYKDQSLRLGELVVSAEQLVVIGATGALCVLLFAMFRYSKLGIAMQAASQNQLAAY
YMGIPVQRLNGLAWGLAAVVAAVAGLLLAPITFVHANMGFIGLKAFPAAVVGGFGSLPGA
IVGGLVIGIVESLSGFYLPDGFKDTAAYIVVLIMLMVKPNGLFGEKLRKKV