Protein Info for Ac3H11_1883 in Acidovorax sp. GW101-3H11

Annotation: dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 65% identical to RMLC_PSEAE: dTDP-4-dehydrorhamnose 3,5-epimerase (rmlC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01790, dTDP-4-dehydrorhamnose 3,5-epimerase [EC: 5.1.3.13] (inferred from 74% identity to dac:Daci_1278)

MetaCyc: 61% identical to dTDP-4-dehydrorhamnose 3,5-epimerase (Escherichia coli K-12 substr. MG1655)
dTDP-4-dehydrorhamnose 3,5-epimerase. [EC: 5.1.3.13]

Predicted SEED Role

"dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13)" in subsystem Capsular heptose biosynthesis or Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 5.1.3.13)

MetaCyc Pathways

O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
dTDP-4-O-demethyl-β-L-noviose biosynthesis (3/5 steps found)
dTDP-L-daunosamine biosynthesis (3/6 steps found)
dTDP-sibirosamine biosynthesis (3/6 steps found)
superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
superpathway of novobiocin biosynthesis (4/19 steps found)
superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.13

Use Curated BLAST to search for 5.1.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KKM1 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Ac3H11_1883 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Acidovorax sp. GW101-3H11)
MQAIRQSIPDVVLIEPKVFGDSRGFFYESFNQQAFNEATGTNHAFVQDNHSRSSQGVLRG
LHYQLPPRAQGKLVRVVRGAVFDVAVDIRKGSPTFGQWVGALLTEDNHRQLWVPPGLAHG
FLVLSESADFLYKTTDYYSPEHERCIRWDDPQLAIAWPSVEAAIQLSAKDQVGRWLAEAD
L