Protein Info for Ac3H11_1841 in Acidovorax sp. GW101-3H11

Annotation: Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 892 transmembrane" amino acids 586 to 611 (26 residues), see Phobius details amino acids 623 to 642 (20 residues), see Phobius details amino acids 647 to 666 (20 residues), see Phobius details amino acids 672 to 695 (24 residues), see Phobius details amino acids 732 to 756 (25 residues), see Phobius details amino acids 785 to 803 (19 residues), see Phobius details amino acids 816 to 835 (20 residues), see Phobius details amino acids 842 to 863 (22 residues), see Phobius details amino acids 869 to 886 (18 residues), see Phobius details PF00005: ABC_tran" amino acids 37 to 187 (151 residues), 106.5 bits, see alignment E=1.8e-34 amino acids 287 to 453 (167 residues), 28.7 bits, see alignment E=2e-10 PF02653: BPD_transp_2" amino acids 617 to 880 (264 residues), 157.6 bits, see alignment E=3.7e-50

Best Hits

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (892 amino acids)

>Ac3H11_1841 Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1) (Acidovorax sp. GW101-3H11)
MPSDAREQPMTPKPPTNTSPPLLAIQAIGKDYTATVLDGVNVELFAGEVLALTGENGAGK
STLSKILCGLEQPTRGGMLLAGQAYAPTSRRDAERHGVRMVMQELGLVPTLTVAENLLMG
RLPHRLGWLQRDVLHAAARAQLAKIGLDSIDPATPVSQLGIGQQQMVEIARNLQDDTRIL
VLDEPTAMLTPRETNYLFEQIAHLTARGVAIIYVSHRLEELRRIADRVAVLRDGRLVDVR
PMAGMSEDDLVQRMVGRVVSDLDHRPRRPVGPVVMSAEGLGRGTAVQGVSLELRAGEIFG
IAGLVGSGRTELVRLLFGADRADRGSVTLHPEFEQKQALPRDGQAQAAIQKIANTPNPAT
AAPRTWQRGFASPLQAIAAGVGLVTEDRKSQGLLLSQPIRINATLSDLSAVSRGGWLQRG
FENRLVQGFVRTLGIRCRSPEQPVGQLSGGNQQKGGVRPLAAPRRPRAAARRTHARRGRG
RPRRAVWRAGPHGPGRPRAAHGVVRPARTHGHGRPHRRDECGPPGGRVRARRVVRAIAAG
GCVLRARRAHQHHTFNFFSCDRMNAPTAPAAPAATPSSASVWRSQLGTYLGLLAVLAGMV
ALFSSLSEYFWSAETFITIANEIPALAVMAVGMTFVLIIAGIDLSVGSVMALAAATSAAA
ILQWGWTVPAAAALALATGLVCGTITGAISVAWRLPSFIVSLGMLEAVRGSAYVVTDSRT
QYVGDAISWLSAPFFGGISFAFLLAVVLVVVAQLVLSRTVFGRCVVGIGTNEEAMRLAGV
DPRPIRVIVFAMTGLLAGLAGLMQSARLEAADPNAGTGMELQVIAAVVIGGTSLMGGRGS
VVNTAFGVLIIAVLEAGLAQVGASEPSKRIITGFVIVAAVIVDTLRQRRAKV