Protein Info for Ac3H11_1806 in Acidovorax sp. GW101-3H11

Annotation: Xanthine-guanine phosphoribosyltransferase (EC 2.4.2.22)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00156: Pribosyltran
  • amino acids 12 to 158 (147 residues), 89.3 bits, E=8.8e-30

Best Hits

KEGG orthology group: K07101, (no description) (inferred from 94% identity to vei:Veis_3161)

Predicted SEED Role

"Xanthine-guanine phosphoribosyltransferase (EC 2.4.2.22)" in subsystem Purine conversions (EC 2.4.2.22)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (12/14 steps found)
• guanine and guanosine salvage I (1/2 steps found)
• guanine and guanosine salvage II (1/2 steps found)
• xanthine and xanthosine salvage (1/2 steps found)
• superpathway of guanine and guanosine salvage (1/3 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.22

Sequence Analysis Tools

See A0A165HXX5 at UniProt or InterPro

Protein Sequence (174 amino acids)

>Ac3H11_1806 Xanthine-guanine phosphoribosyltransferase (EC 2.4.2.22) (Acidovorax sp. GW101-3H11)
MLTEDGKHLYVSYDEYHSLIEKLALKVHQSGWAFDTILCLARGGLRPGDILSRIFDKPLA
IMSTSSYRAEAGTVQGHLDIARFITTPKGEIAGKVLLVDDLADSGHTLHAVIDMLKTNYA
PITELRSAVIWTKGLSTFTPDYSVEFLPTNPWIHQPFEGYDSLGPEKLLEKWRV