Protein Info for Ac3H11_1741 in Acidovorax sp. GW101-3H11

Annotation: BatA (Bacteroides aerotolerance operon)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 320 to 344 (25 residues), see Phobius details PF07584: BatA" amino acids 1 to 75 (75 residues), 38.1 bits, see alignment E=2.5e-13 PF00092: VWA" amino acids 88 to 177 (90 residues), 28.2 bits, see alignment E=3.2e-10 amino acids 222 to 304 (83 residues), 24.9 bits, see alignment E=3.2e-09 PF13519: VWA_2" amino acids 88 to 176 (89 residues), 58.6 bits, see alignment E=1.4e-19

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 83% identity to adk:Alide2_3750)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KDB6 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Ac3H11_1741 BatA (Bacteroides aerotolerance operon) (Acidovorax sp. GW101-3H11)
MVFLWPTLLWLLLVAPLLVLLYWWLLHRRKKTALNYSSLSLVREALGPGQRLRRHIPPAL
FLLALIALLLAAARPLAVITLPSQDQTIMLAMDVSGSMRAADVEPDRITAAQNAAKAFIA
ELPRHVRVGIVAFAGSAQLAQLPTQSREDLVKAIDSFQLQRGTATGNGIMLSLATLFPDA
GIDISALGGRQAMRPKPIDEIGKQDPAKPFTPVAPGSYNSAAIIMLTDGQRTTGVDPLEA
AKWAADRGVRVYTVGVGTVQGETIGFEGWSMRVRLDEETLKAVAARTNAEYFHAATAADL
KKVYQTLSSRLTVEKRETEISALFALAGAALALLAAALSVWWYGRVM