Protein Info for Ac3H11_1727 in Acidovorax sp. GW101-3H11

Annotation: 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF00106: adh_short" amino acids 8 to 213 (206 residues), 93.9 bits, see alignment E=9.6e-31 PF13561: adh_short_C2" amino acids 14 to 273 (260 residues), 105.8 bits, see alignment E=2.8e-34

Best Hits

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 79% identity to adk:Alide2_3737)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KD21 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Ac3H11_1727 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) (Acidovorax sp. GW101-3H11)
MDLGIAGKWALVCGASKGLGYGCALALVREGVHVVINARNAEALDQAATRLIAECASQAR
AKGLKESEIQTPKVLAVAADITTPVGREAVFSVAGGPGRDFDMVVTNAGGPPTGDFRDWN
RDAWIKAVDANMLTPIELIQATVDGMAVRGFGRIVNITSSAVKAPIDILGLSNGARSGLT
GFVAGVSRSKIAARGVTINNLLPGKFDTDRLAATVTAAAGKAGKSVEDVRAVQQAQIPAG
RYGTAEEFGAICAFLCSQQAGYMTGQNVLADGGAYPGTF