Protein Info for Ac3H11_1724 in Acidovorax sp. GW101-3H11

Annotation: Permeases of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 280 to 297 (18 residues), see Phobius details PF00892: EamA" amino acids 11 to 141 (131 residues), 79.1 bits, see alignment E=1.8e-26 amino acids 156 to 297 (142 residues), 49.6 bits, see alignment E=2.3e-17

Best Hits

KEGG orthology group: None (inferred from 80% identity to aaa:Acav_3356)

Predicted SEED Role

"Permeases of the drug/metabolite transporter (DMT) superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KD03 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Ac3H11_1724 Permeases of the drug/metabolite transporter (DMT) superfamily (Acidovorax sp. GW101-3H11)
MTHKLTPGTAVLLVIPPLLWAGNAVTGRLVHDLISPAALNFIRWVLAFFILLPLAHGVLR
TNSPLWPHWRRYALLGLLGIGLYNALQYMALQTSTPINATLVGSSMPVWMLAVGALFFGA
AVTRRQVVGALLSVCGVLLVLSRGEWAQLLAFRLVPGDLFMLLATISWAFYSWLLARTSE
PGSIRGDWAAFLMAQMVFGLAWSGSFAGAEWATGHTHTTWGWPLVAALAFIAVGPAVLAY
RCWGVGVQRAGPAVAGFFVNLTPLFAGLLSAAFLGETPQAFHGVAFALIVGGIVVSSRR