Protein Info for Ac3H11_1663 in Acidovorax sp. GW101-3H11

Annotation: putative esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF00135: COesterase" amino acids 58 to 190 (133 residues), 49.8 bits, see alignment E=5.5e-17 PF20434: BD-FAE" amino acids 67 to 165 (99 residues), 64.1 bits, see alignment E=2.6e-21 PF12697: Abhydrolase_6" amino acids 74 to 204 (131 residues), 29 bits, see alignment E=3.3e-10 PF07859: Abhydrolase_3" amino acids 74 to 167 (94 residues), 50.3 bits, see alignment E=5.2e-17

Best Hits

KEGG orthology group: None (inferred from 59% identity to pol:Bpro_1716)

Predicted SEED Role

"putative esterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KBJ5 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Ac3H11_1663 putative esterase (Acidovorax sp. GW101-3H11)
MSLPLNDPAWLERMYNNRALVPDHMDYLQRWARDSAQVRAQVPCVLDVAYGTGPGETLDV
FPSTRPAGAPVPVLVFIHGGYWRALDKSDHSFIAPPFNQAGFCVVVVNYALCPGTPEAPV
TIPHIVRQMEKAVAWVARNIEAHGGDARRITVAGHSAGGHLAAMLLTSVWPLIGAGLPDG
LVRNALSISGLHDLEPLMHTPFLQEALHLTDQHVLQDSPARLLAPEHGILYCVAGGDESE
EFHRQNGLVQQAWGVHSVPRCQVLPGLHHFSILDTLAQPGKDLHHMAQNLLRM