Protein Info for Ac3H11_1637 in Acidovorax sp. GW101-3H11

Annotation: Zinc transporter, ZIP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details PF02535: Zip" amino acids 4 to 275 (272 residues), 111.2 bits, see alignment E=3.3e-36

Best Hits

KEGG orthology group: None (inferred from 79% identity to aav:Aave_1944)

Predicted SEED Role

"Zinc transporter, ZIP family" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165KAY5 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Ac3H11_1637 Zinc transporter, ZIP family (Acidovorax sp. GW101-3H11)
MTLIAIILATLAAGIGSVWLAALLMRLGLGGRADSVGPQHLLSLAAGALLATAFMHLLPE
AFESQAGAHDLFATLLVGVVFFFLLDKAELWHHGHEHSHPAPAAQDHAHGQGHTHDAHHG
HDHGHAHHHHGPRSGGWAVLTGDSVHCFGDGILIASAFLADIRLGVIAAVSVLAHEVPHH
MGDLVVLRQTSTNRRMALVKVSLAGAVTALGGVVGYFLVGQLQDFLPYFLAVASSSFVYV
ALADLIPQLQKRLTARETIAQIAWLIAGMVIVTLVSGAAHAH