Protein Info for Ac3H11_161 in Acidovorax sp. GW101-3H11

Annotation: TRAP-type transport system, periplasmic component, predicted N-acetylneuraminate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03480: DctP" amino acids 30 to 310 (281 residues), 310.8 bits, see alignment E=4.5e-97 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 31 to 282 (252 residues), 263.6 bits, see alignment E=9.1e-83

Best Hits

Swiss-Prot: 85% identical to DCTP_VEREI: Solute-binding protein Veis_3954 (Veis_3954) from Verminephrobacter eiseniae (strain EF01-2)

KEGG orthology group: None (inferred from 91% identity to dia:Dtpsy_1744)

MetaCyc: 41% identical to 2,3-diketo-L-gulonate:Na+ symporter - periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"TRAP-type transport system, periplasmic component, predicted N-acetylneuraminate-binding protein" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IXS0 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Ac3H11_161 TRAP-type transport system, periplasmic component, predicted N-acetylneuraminate-binding protein (Acidovorax sp. GW101-3H11)
MQLTRLVVGLSLALGFVATAAAQTTMRISISTAQNSHQGIAIDTFAKEVEKRTSGRYKVQ
TFYNGALGGERESIEAVQLGTQELAFSSTGPIPNFVPETKILDVPFLFRDKAHARAVLDG
PIGQEMLTKFDSKGFKALAWAENGFRHMTNSKRSVNTPEDLKGLKMRTMENPVHIAAYKG
FGIITTPMAFPEVFTALQQGTVDGQENPLPVIISAKFDQVQKHLTLTGHVYSPAIFVMNK
GSFDKLSAADKQAFIDAAKEGTKANRARVDEDDAKGVADLRAKGMTVVDNPDKSKFVAAL
APVNAEFEKQFGKATLDKIRDVK