Protein Info for Ac3H11_1584 in Acidovorax sp. GW101-3H11

Annotation: Septum formation protein Maf

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF02545: Maf" amino acids 1 to 181 (181 residues), 173.6 bits, see alignment E=1.9e-55 TIGR00172: septum formation protein Maf" amino acids 1 to 180 (180 residues), 150.1 bits, see alignment E=2.5e-48

Best Hits

Swiss-Prot: 80% identical to NTPPB_POLSJ: 7-methyl-GTP pyrophosphatase (Bpro_3654) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K06287, septum formation protein (inferred from 88% identity to vei:Veis_3264)

MetaCyc: 51% identical to m7GTP pyrophosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-7079

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K9S1 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Ac3H11_1584 Septum formation protein Maf (Acidovorax sp. GW101-3H11)
LGSTSRYRRELLERLNLPFEVAAPDVDETPLPGEAPRDLALRLALAKARAVAQQHPGAVV
IGSDQVADLAGKPLGKPGQHERAVQQLRQMRGQTVVFQTALAVVCAATGFEQADLAPVEV
KFRDLSDEEIERYLRAEQPYDCAGSAKSEGLGIALLDAIHSDDPTALIGLPLIRTCRMLR
AAGLVLP