Protein Info for Ac3H11_1581 in Acidovorax sp. GW101-3H11

Annotation: Phosphate:acyl-ACP acyltransferase PlsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02504: FA_synthesis
  • amino acids 3 to 320 (318 residues), 337 bits, E=5.5e-105
• TIGR00182: fatty acid/phospholipid synthesis protein PlsX
  • amino acids 3 to 329 (327 residues), 347 bits, E=5.6e-108

Best Hits

Swiss-Prot: 89% identical to PLSX_VEREI: Phosphate acyltransferase (plsX) from Verminephrobacter eiseniae (strain EF01-2)

KEGG orthology group: K03621, glycerol-3-phosphate acyltransferase PlsX [EC: 2.3.1.15] (inferred from 89% identity to vei:Veis_3253)

Predicted SEED Role

"Phosphate:acyl-ACP acyltransferase PlsX" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• oleate biosynthesis III (cyanobacteria) (2/3 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
• palmitoyl ethanolamide biosynthesis (2/6 steps found)
• superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
• stigma estolide biosynthesis (2/7 steps found)
• anandamide biosynthesis II (2/8 steps found)
• anandamide biosynthesis I (4/12 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

See A0A165K9N6 at UniProt or InterPro

Protein Sequence (350 amino acids)

>Ac3H11_1581 Phosphate:acyl-ACP acyltransferase PlsX (Acidovorax sp. GW101-3H11)
MITLAVDCMGGDHGPRVTLAACRQFLEHHPDARLLLVGLPGSLQAFAHDRAAIVPASEVV
AMDDPVEVALRKKKDSSMRVAIQQVKDGAASAAVSAGNTGALMAIARYLLKTLDGIDRPA
IATQLPNATGGATTVLDLGANVDCSAEHLLQFAVMGSALVSALQEGGEPTVGLLNIGEEV
IKGSEVIKKAGELLRSAASSGDLNFFGNVEGNDIFKGTVDIVVCDGFVGNVALKASEGVA
SMVIGALKTEFSRHIFTKMAAIIAYPILKALMKRMDYRRYNGAALLGLRGLVFKSHGSAD
AMAFEQALNRAYDAARNNLLDRVRTRIAHAAPLLVPADAQPQPGAAATTH