Protein Info for Ac3H11_1580 in Acidovorax sp. GW101-3H11

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 4 to 324 (321 residues), 419.1 bits, see alignment E=5.5e-130 PF00108: Thiolase_N" amino acids 43 to 151 (109 residues), 32.4 bits, see alignment E=9.8e-12 PF08545: ACP_syn_III" amino acids 113 to 190 (78 residues), 115.7 bits, see alignment E=1.1e-37 PF08541: ACP_syn_III_C" amino acids 236 to 324 (89 residues), 126.5 bits, see alignment E=5.6e-41

Best Hits

Swiss-Prot: 90% identical to FABH_DELAS: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Delftia acidovorans (strain DSM 14801 / SPH-1)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 90% identity to dac:Daci_5272)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K9M0 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Ac3H11_1580 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180) (Acidovorax sp. GW101-3H11)
MRRYSRITGTGSYLPPRRLTNADLVAELGQRGIETSDEWIVERTGIRARHFAAPDVASSD
LGLEAARNALQAAGLQPTDIDLIIVATSTPDMVFPSTACILQNKLGANGCPAFDVQAVCS
GFVYALSVADAMIQTGAANRALVIGAEVFSRILDFNDRTTCVLFGDGAGAVVLEASETPG
ILSSDLHADGKHVGILCVPGNVSGGQVLGDPLLKMDGQAVFKLAVGVLEKAAHAALAKAG
LTEADIDWLIPHQANIRIMQGTARKLKLSMDKVVVTVDQHGNTSAASIPLALDHAVRSGQ
VHKGQTLLLEGVGGGFAWGAVLLKL