Protein Info for Ac3H11_1571 in Acidovorax sp. GW101-3H11

Annotation: Sigma factor RpoE negative regulatory protein RseB precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF03888: MucB_RseB" amino acids 61 to 236 (176 residues), 177.7 bits, see alignment E=1.7e-56 PF17188: MucB_RseB_C" amino acids 256 to 356 (101 residues), 80.1 bits, see alignment E=1.1e-26

Best Hits

KEGG orthology group: K03598, sigma-E factor negative regulatory protein RseB (inferred from 81% identity to vei:Veis_3244)

Predicted SEED Role

"Sigma factor RpoE negative regulatory protein RseB precursor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K9H2 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Ac3H11_1571 Sigma factor RpoE negative regulatory protein RseB precursor (Acidovorax sp. GW101-3H11)
VMNTLGVLGAAGIFRNRWLMWCGAVVASGLVASAALAAGPGGGNPAAASSEAISVPAERD
VAQWIERMHSAPCRKSYAGVFVVMSANGAMSSSRIWHACDGLQQMERVESLSGTPRTVFR
RNDEVRTFLPQARVVRTDRRDAAGLFPRVPVVSGTSTAQFYTSQLIGQERVAGLVSDVVW
FKPLDALRFGYRLWVERDSGLVVKLQTLALDGRVLEQAAFSELDLNASVRVEQLSRLMDS
TMGYKVVAPAVVKTTAQAEGWALRQPVAGFVPVSCHRRAVSGADDAQSVLQCLYSDGLAS
VSLFLESFDPQRHPAQSQVSGMGATQLLAQRVSPDTWLTAVGEVPLQTLRLFAGQLERVR