Protein Info for Ac3H11_1565 in Acidovorax sp. GW101-3H11

Annotation: GTP-binding protein Era

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR00231: small GTP-binding protein domain" amino acids 41 to 201 (161 residues), 98.5 bits, see alignment E=3.6e-32 TIGR00436: GTP-binding protein Era" amino acids 42 to 316 (275 residues), 271.3 bits, see alignment E=8.6e-85 PF02421: FeoB_N" amino acids 44 to 194 (151 residues), 49.1 bits, see alignment E=2.2e-16 PF00071: Ras" amino acids 44 to 203 (160 residues), 25.3 bits, see alignment E=4.6e-09 PF04548: AIG1" amino acids 44 to 144 (101 residues), 31.2 bits, see alignment E=6.3e-11 PF01926: MMR_HSR1" amino acids 44 to 157 (114 residues), 86.4 bits, see alignment E=7e-28 PF07650: KH_2" amino acids 241 to 321 (81 residues), 65.9 bits, see alignment E=1e-21

Best Hits

Swiss-Prot: 61% identical to ERA_RALSO: GTPase Era (era) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03595, GTP-binding protein Era (inferred from 85% identity to vei:Veis_3237)

Predicted SEED Role

"GTP-binding protein Era" in subsystem Bacterial Cell Division or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K9B9 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Ac3H11_1565 GTP-binding protein Era (Acidovorax sp. GW101-3H11)
MNDATKNVAGDEGAESAPVQNDLEAMLAAAAVPAAVPGQRCGVIAIVGKPNVGKSTLLNA
LVGQKISITSRKAQTTRHRITGIRTREQTQFIFVDTPGFQTRHATALNKSLNKTVMGAIG
DVDLILFVVEAGNFTLADAKVLSLFKPGIPTLLVANKLDMVHRRAELAPWLKSMQERHPF
AEFVPMSAKNKGDIERMFGICAKYLPEQAWWYAEDELTDRSEKFLASETVREKLFRFTGD
ELPYTSTVVIDKFDEEKSKQHKRLVKIAATIVVERDNHKMMVIGDKGERLKRIGTEARQE
LEKLMDAKVFLELWVKVRSGWADDEARVRSFGYE