Protein Info for Ac3H11_1563 in Acidovorax sp. GW101-3H11

Annotation: Pyridoxine 5'-phosphate synthase (EC 2.6.99.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 74% identical to PDXJ_RHOFT: Pyridoxine 5'-phosphate synthase (pdxJ) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K03474, pyridoxine 5-phosphate synthase [EC: 2.6.99.2] (inferred from 85% identity to vei:Veis_2344)

Predicted SEED Role

"Pyridoxine 5'-phosphate synthase (EC 2.6.99.2)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.6.99.2)

MetaCyc Pathways

pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (7/12 steps found)

KEGG Metabolic Maps

Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K996 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Ac3H11_1563 Pyridoxine 5'-phosphate synthase (EC 2.6.99.2) (Acidovorax sp. GW101-3H11)
MNQPSLPASHPTTALSVNVNKVALLRNTRHLGIPSVTRAAELCLQAGAQGITVHPRPDAR
HIRSHDVFELAALMKAWPDREYNIEGNPSQNLMDFIRQVRPHQATFVPDSEDQFTSDHGW
SFPQDAERLAPLIAECKALGVRVSLFMDPVPGQMAAARAMGADRVELYTEPYAAAWGTPQ
HAVELKRYAAAAQAALDAGLGVNAGHDLNRDNLAAFVREVPGVLEVSIGHALIADALELG
YTATVQAYLACIQAGFTGTINNS