Protein Info for Ac3H11_1512 in Acidovorax sp. GW101-3H11

Annotation: Replicative DNA helicase (EC 3.6.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 TIGR00665: replicative DNA helicase" amino acids 29 to 467 (439 residues), 587.2 bits, see alignment E=1.9e-180 PF00772: DnaB" amino acids 29 to 130 (102 residues), 119.5 bits, see alignment E=9.4e-39 TIGR03600: phage replicative helicase, DnaB family" amino acids 32 to 456 (425 residues), 499.8 bits, see alignment E=6.8e-154 PF03796: DnaB_C" amino acids 207 to 465 (259 residues), 369.4 bits, see alignment E=1.3e-114 PF13481: AAA_25" amino acids 221 to 389 (169 residues), 43.8 bits, see alignment E=3.4e-15

Best Hits

Swiss-Prot: 48% identical to DNAB_HAEIN: Replicative DNA helicase (dnaB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 89% identity to aaa:Acav_1249)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K826 at UniProt or InterPro

Protein Sequence (474 amino acids)

>Ac3H11_1512 Replicative DNA helicase (EC 3.6.1.-) (Acidovorax sp. GW101-3H11)
MSAVFPPLDEQGSLPSASEDQEIAKLRTPPHSIEAESSVLGGLLLDNNAWDRVGDLLKEG
DFYRYEHQAIYAAIGALINASKPADVITVFEQLKNQGKAQEMGGLTYLNSLAQYVPSATN
IRRYAEIVRERAILRKLVTASDEISTNAFNPQGKTVERILDEAEAKIFAIGEEGSRNKQG
FQSLDNLVIDLLDKVQEMADNPADVTGVPTGFADLDRMTSGLQAGDMIVLAARPSMGKTS
FAVNIAEHVALNEGLPVAIFSMEMGAAQLAVRIVGSIGRVNQGNLRSGKLTDDEWPRLTE
AIERLRTVSLHIDETPGLSPGELRANARRLARQCGKLGLIVVDYLQLMSGSGSAASSDNR
ATELGEISRGLKMLAKELQCPVIALSQLNRSVEQRTDKRPMMSDLRESGAIEQDADIIMF
IYRDDYYNKDSKEPNVAEVIIGKQRNGPTGTVKLFFQKNQTRFENLAMGGGDDY