Protein Info for Ac3H11_1511 in Acidovorax sp. GW101-3H11

Annotation: Predicted ATPase related to phosphate starvation-inducible protein PhoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 586 PF13638: PIN_4" amino acids 129 to 275 (147 residues), 116.4 bits, see alignment E=1.8e-37 PF02562: PhoH" amino acids 372 to 572 (201 residues), 158.3 bits, see alignment E=2.9e-50 PF13604: AAA_30" amino acids 376 to 540 (165 residues), 27 bits, see alignment E=5.3e-10

Best Hits

KEGG orthology group: K07175, PhoH-like ATPase (inferred from 84% identity to vei:Veis_0987)

Predicted SEED Role

"Predicted ATPase related to phosphate starvation-inducible protein PhoH" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K820 at UniProt or InterPro

Protein Sequence (586 amino acids)

>Ac3H11_1511 Predicted ATPase related to phosphate starvation-inducible protein PhoH (Acidovorax sp. GW101-3H11)
MPLPPAPSRRAALLAPEAFEVTARPRVSQTSANEPVAAPVRAASATRTGRKAGSAALATP
AALVAAPLIQVETQARVPEPASSPTTPTARATGTRKARTTSVTASPSATAPAPAPRGKKA
APQGPTKLFVLDTNVLLHDPTSLFRFEEHDIFLPMIVLEELDGHKKGMTEVARNGRQTSR
TLDALAGVQGADIAHGLKLDSTGQRAAGGHLFFQTAPLDYSLPTSLPPGKADNQILGVVE
ALRKLHAPREVVLVSKDINMRVKARALGLNAEDYQNDKTLEDGDLLYAGVLALPPDFWAK
SGKNVESWQSGAHTYYRIGGPIVPQLMINQFVYFEAPGEPSLFARVSEIREKTAVLQTLK
DYGSAKNAVWGVTTRNREQNYAMNLLMDPEIDFVTLTGTAGTGKTLLALAAGLTQVLDDR
RYTEIIMTRATVSVGEDIGFLPGTEEEKMGPWMGALDDNLEFLAKGDGGNAGEWGRAATN
ELIRSRIKIKSMNFMRGRTFLNKYVIIDEAQNLTPKQMKTLITRAGPGTKIICMGNLAQI
DTPYLTEGSSGLTYAVDRFKGWPHSGHITLARGERSRLADFASEVL