Protein Info for Ac3H11_1503 in Acidovorax sp. GW101-3H11

Annotation: Molybdopterin biosynthesis protein MoeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 PF03453: MoeA_N" amino acids 7 to 172 (166 residues), 152.4 bits, see alignment E=1.3e-48 TIGR00177: molybdenum cofactor synthesis domain" amino acids 182 to 326 (145 residues), 91 bits, see alignment E=3.6e-30 PF00994: MoCF_biosynth" amino acids 186 to 328 (143 residues), 104 bits, see alignment E=9e-34 PF03454: MoeA_C" amino acids 345 to 409 (65 residues), 30.5 bits, see alignment E=5.2e-11

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 78% identity to adn:Alide_3267)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K7T0 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Ac3H11_1503 Molybdopterin biosynthesis protein MoeA (Acidovorax sp. GW101-3H11)
MKPLKALDDALAELLAHATPLPGTDTVTTFDADGRVLAQDCVSALQVPPQDNSSMDGYAV
RCADVAAAGVVLPVSQRIPAGSAGYPLQPGTAARIFTGAPVPAGADAILMQEDCEALAAA
AAGGLGAVCINAVPQAGQWIRSAGEDITRGGVVLSAGTRLTPAELGLAASIGQHQLQVAR
RPRVALFSTGDELVMPGEVPPEQMRPGAIYNSNRFFLRAMLLRLGCEVTDFGIVPDRRDA
TIAALRDASAAHDLILTSGGVSVGEEDHIKPAVESLGTLDLWQIAMKPGKPFAYGQIPRE
GGAAHFMGLPGNPVSSFLTFALLVRPFVLRLQGVLDVASQSVAMRADFSWPKADKRREFL
RVRHNAAGGLDLFNNQSSGVLTSAAWGDGVVDNPAGQTIAACDTVRYIAFSELLA