Protein Info for Ac3H11_1452 in Acidovorax sp. GW101-3H11

Annotation: NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00507: Oxidored_q4
  • amino acids 2 to 94 (93 residues), 137.8 bits, E=6.1e-45

Best Hits

Swiss-Prot: 79% identical to NUOA_ACIF5: NADH-quinone oxidoreductase subunit A (nuoA) from Acidithiobacillus ferrooxidans (strain ATCC 53993)

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 80% identity to lhk:LHK_00527)

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (95 amino acids)

>Ac3H11_1452 NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3) (Acidovorax sp. GW101-3H11)
VLGYILGPNRPDAAKNSPYECGFEAFEDARMKFDVRYYLVAILFILFDLEIAFLFPWAVT
LHDVGMAGFVAVVIFLAILVVGFAYEWKKGALDWE