Protein Info for Ac3H11_1444 in Acidovorax sp. GW101-3H11

Annotation: NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01971: NADH-quinone oxidoreductase, chain I
  • amino acids 27 to 148 (122 residues), 152.5 bits, E=1.9e-49
• PF13237: Fer4_10
  • amino acids 68 to 121 (54 residues), 29.8 bits, E=2.1e-10
• PF00037: Fer4
  • amino acids 68 to 87 (20 residues), 24.4 bits, see alignment (E = 9e-09)
  • amino acids 104 to 125 (22 residues), 30.2 bits, see alignment (E = 1.3e-10)
• PF12800: Fer4_4
  • amino acids 69 to 82 (14 residues), 17 bits, see alignment (E = 2.8e-06)
  • amino acids 108 to 122 (15 residues), 13.1 bits, see alignment (E = 4.9e-05)
• PF13187: Fer4_9
  • amino acids 70 to 123 (54 residues), 34.2 bits, E=9.4e-12
• PF12838: Fer4_7
  • amino acids 70 to 123 (54 residues), 43.8 bits, E=1.3e-14

Best Hits

Swiss-Prot: 95% identical to NUOI_VEREI: NADH-quinone oxidoreductase subunit I (nuoI) from Verminephrobacter eiseniae (strain EF01-2)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 95% identity to vei:Veis_2805)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See A0A165K6M9 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Ac3H11_1444 NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3) (Acidovorax sp. GW101-3H11)
MTAVVAAAPFSFKDFFKSFMLVELVKGMALTGRYAFRRKVTVQFPEEKTPLSPRFRGLHA
LRRYDNGEERCIACKLCEAVCPAMAITIESDVRADGSRRTTRYDIDLTKCIFCGFCEESC
PVDSIVETHIFEYHGEKRGDLYFTKDMLLAVGDRYEGEIAAAKAADAKYR