Protein Info for Ac3H11_1425 in Acidovorax sp. GW101-3H11

Annotation: Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF00072: Response_reg" amino acids 1 to 103 (103 residues), 77.9 bits, see alignment E=6.5e-26 PF01339: CheB_methylest" amino acids 165 to 343 (179 residues), 217.8 bits, see alignment E=9.2e-69

Best Hits

Swiss-Prot: 82% identical to CHEB1_RHOFT: Protein-glutamate methylesterase/protein-glutamine glutaminase 1 (cheB1) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 93% identity to aav:Aave_4374)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K0I4 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Ac3H11_1425 Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61) (Acidovorax sp. GW101-3H11)
VIVVDDSALVRSLLSEIINRQRDMECIGTANDPLVAREMIRELNPDVITLDVEMPRMDGI
DFLGRLMRLRPMPVVMISTLTERGAEVTMKALELGAIDFVAKPRVGLASGLNDLAAQIVD
KIRVAAVAQVRRAPVRDAAPAGGGAAHASAPAAALLGRLSTEKLICIGASTGGTEAIKEV
LVQMPADSPAIVITQHMPPGFTTSFAARLNGLCQITVKEAVNGERILPGHAYIAPGGTQF
HVARSGANYVAVVDDGPPVNRHKPSVEVLFKSAAAVVGRNAFGIMLTGMGNDGAAAMREM
KDAGSYNYVQDEATCIVFGMPREAIAHGAADEVLPLGQIAPALITRLRGATDRLHHRI