Protein Info for Ac3H11_1414 in Acidovorax sp. GW101-3H11

Annotation: Flagellar biosynthesis protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 59 to 88 (30 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 198 to 222 (25 residues), see Phobius details amino acids 233 to 257 (25 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 62 to 257 (196 residues), 285.2 bits, see alignment E=1.4e-89 PF00813: FliP" amino acids 62 to 253 (192 residues), 275.1 bits, see alignment E=1.8e-86

Best Hits

Swiss-Prot: 59% identical to FLIP_SALTY: Flagellar biosynthetic protein FliP (fliP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 87% identity to ajs:Ajs_3797)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K0S7 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Ac3H11_1414 Flagellar biosynthesis protein FliP (Acidovorax sp. GW101-3H11)
MPAPAKGRSAGHRWLLAAFVGLLTLAVQGPAFAQAAGSLPLVVGSGPSGTSYSVPIQTLL
FFTALSFLPAVLLMMTGFTRIVIVLSLLRQALGTQSAPPNQVIIGLSLFLTFFVMGPTLD
RVYQEAYVPYTNNTITFEQALDKAEAPMRGFMLKQTRQSDFALFSRLARLDPNVTAETAP
MRVLVPAFVTSELKSAFQIGFMIFIPFLVIDMVVSSILMSLGMMMLSPVLVALPFKLMLF
VLADGWNLLIGSLAASFVT