Protein Info for Ac3H11_1389 in Acidovorax sp. GW101-3H11

Annotation: Flagellar motor rotation protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details PF20560: MotA_N" amino acids 1 to 69 (69 residues), 80.5 bits, see alignment E=8.6e-27 TIGR03818: flagellar motor stator protein MotA" amino acids 7 to 257 (251 residues), 350.8 bits, see alignment E=2.4e-109 PF01618: MotA_ExbB" amino acids 104 to 213 (110 residues), 46.6 bits, see alignment E=2.8e-16

Best Hits

Swiss-Prot: 51% identical to MOTA_ECOLI: Motility protein A (motA) from Escherichia coli (strain K12)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 93% identity to aav:Aave_4408)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JZP3 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Ac3H11_1389 Flagellar motor rotation protein MotA (Acidovorax sp. GW101-3H11)
VILKALPFEIITILGGALGAFVVNNQPKVIKATLAALPMALKGSKYTKDRYMELMAMLYD
ILQKARKEGLMAIEKDVETPHESEIFKKYPTVGSDHHVIEFTTDYLRMMVSGNLNSHEIE
ALMDSEIDTHHQEAHAPVAALARLAGALPAFGIVAAVLGVVNTMGSVGQPPSVLGGMIGS
ALVGTFLGILLAYGVVEPLGGLVEQKTEDAAKELQCIKSTLLASMQGYNPATAIEFGRKV
LFSDVRPSFTELEGHVKGKK