Protein Info for Ac3H11_1387 in Acidovorax sp. GW101-3H11

Annotation: Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 PF00072: Response_reg" amino acids 8 to 119 (112 residues), 112.9 bits, see alignment E=4.5e-37

Best Hits

Swiss-Prot: 70% identical to CHEY_YEREN: Chemotaxis protein CheY (cheY) from Yersinia enterocolitica

KEGG orthology group: K03413, two-component system, chemotaxis family, response regulator CheY (inferred from 97% identity to aaa:Acav_4305)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JZM0 at UniProt or InterPro

Protein Sequence (128 amino acids)

>Ac3H11_1387 Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY (Acidovorax sp. GW101-3H11)
VTTALRFLIVDDFSTMRRIVRNLLKESGFSDADEAEDGVAALNKLRNSKFDFVVTDINMP
NMNGFQLLAEIKKDDKLKHLPVLMVTAEARKEDIVAAAQGGAAGYIVKPFTKATLEEKVT
LILKKMGL