Protein Info for Ac3H11_1318 in Acidovorax sp. GW101-3H11

Annotation: Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR00878: phosphoribosylformylglycinamidine cyclo-ligase" amino acids 10 to 337 (328 residues), 437.7 bits, see alignment E=1.4e-135 PF00586: AIRS" amino acids 62 to 167 (106 residues), 81.8 bits, see alignment E=5e-27 PF02769: AIRS_C" amino acids 179 to 345 (167 residues), 119.7 bits, see alignment E=1.4e-38

Best Hits

Swiss-Prot: 92% identical to PUR5_POLSJ: Phosphoribosylformylglycinamidine cyclo-ligase (purM) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K01933, phosphoribosylformylglycinamidine cyclo-ligase [EC: 6.3.3.1] (inferred from 92% identity to pol:Bpro_3566)

MetaCyc: 57% identical to phosphoribosylformylglycinamide cyclo-ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylformylglycinamidine cyclo-ligase. [EC: 6.3.3.1]

Predicted SEED Role

"Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)" in subsystem De Novo Purine Biosynthesis (EC 6.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JXH3 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Ac3H11_1318 Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (Acidovorax sp. GW101-3H11)
MSSSASSTPISYKDAGVDIDAGDALVERIKPLAKKTMREGVLAGIGGFGALFEVPKRYQE
PVLVSGTDGVGTKLKLAFEWNMHDTVGIDLVAMSVNDVLVQGAEPLFFLDYFACGKLDVD
TAAAVVGGIAKGCELSGCALIGGETAEMPGMYPAGEYDLAGFAVGAVEKSKILTGRDVKP
GDVVLGLASAGVHSNGFSLVRKCIDRAGDSAPATLDGKPFKQAIMEPTRLYVKNVLAALA
AHPIKALAHITGGGLLENIPRVLPEGTAAHLTKGSWPQTELFAWLQKTAGIDDIEMNRTF
NNGIGMVVVVDAANAEATAATLRAAGEQVYTIGAIAARGDGAAVVVA