Protein Info for Ac3H11_1212 in Acidovorax sp. GW101-3H11

Annotation: Secretion protein HlyD precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 50 to 367 (318 residues), 212.3 bits, see alignment E=4.5e-67 PF16576: HlyD_D23" amino acids 75 to 287 (213 residues), 62.3 bits, see alignment E=8.3e-21 PF13533: Biotin_lipoyl_2" amino acids 80 to 123 (44 residues), 28.2 bits, see alignment 2.6e-10 PF13437: HlyD_3" amino acids 187 to 280 (94 residues), 61.3 bits, see alignment E=2.6e-20

Best Hits

KEGG orthology group: None (inferred from 71% identity to vei:Veis_4833)

Predicted SEED Role

"Secretion protein HlyD precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LBN2 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Ac3H11_1212 Secretion protein HlyD precursor (Acidovorax sp. GW101-3H11)
MPTQRFQFSATAFAVIAACVLATGGALVYSGASRAADEPKTGQPRPALTVSMAQPQRTAV
PVRLAANGNVAAWQEASIGAESNGLRLTDVRVNVGDVVKAGQVLATFSAETVQADVAQVR
ASLLEAQANAAEAAANADRARALQATGALSQQQIQQFTTAEKTAQARVEAAQATLNAQQL
RLKYTQVVAPDSGVISARTATVGAVVGAGTELFRMVRKGRLEWRAEVTSTELGRIAPGAK
VSVTAASGATAEGTVRMVAPTVDPQTRNALVYVDLPANADFRAGMFARGEFALGSSDALT
VPQEALVVRDGFSYVFVVGPEQRVQQRKVQAGRRVADRVEVLAGLDAKASVAVRGAGFLN
DGDLVRVAAAPATPGAPVQTSAVGDSKQKQPSPRDGKALNAIN