Protein Info for Ac3H11_1186 in Acidovorax sp. GW101-3H11

Annotation: 2-pyrone-4,6-dicarboxylic acid hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 89% identical to LIGI_COMTE: 2-pyrone-4,6-dicarbaxylate hydrolase (pmdD) from Comamonas testosteroni

KEGG orthology group: K10221, 2-pyrone-4,6-dicarboxylate lactonase [EC: 3.1.1.57] (inferred from 92% identity to pna:Pnap_2029)

MetaCyc: 89% identical to 2-pyrone-4,6-dicarboxylate hydrolase (Comamonas testosteroni)
2-pyrone-4,6-dicarboxylate lactonase. [EC: 3.1.1.57]

Predicted SEED Role

"2-pyrone-4,6-dicarboxylic acid hydrolase"

MetaCyc Pathways

protocatechuate degradation I (meta-cleavage pathway) (8/8 steps found)
superpathway of vanillin and vanillate degradation (9/10 steps found)
methylgallate degradation (6/6 steps found)
gallate degradation II (4/5 steps found)
syringate degradation (8/12 steps found)

KEGG Metabolic Maps

Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LAY9 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Ac3H11_1186 2-pyrone-4,6-dicarboxylic acid hydrolase (Acidovorax sp. GW101-3H11)
MSKPTSGPFEKTPGWLDWYTGPSKPRFQVHAGAVDAHCHVFGPGAEFPYAPERKYTPCDA
SKHQLYALRDHLGFARNVVVQATCHGADNRAMVDALVHSGGKARGVATVKRSVSDEELQA
MHDAGVRGVRFNFVKRLVDFTPKDELMEIAARIHQLGWHVVIYFEAVDLPELWDFFTALP
TTVVVDHMGRPDVNKPVDGPEFELFLKFMRQHPNVWSKVSCPERLSVAGPKALNGEQNAY
TDVIPFARKVVEEFPDRVLWGTDWPHPNLKDHMPDDGLLVDFIPHIATTPELQKKLLVDN
PMRLYWPEEVTVED