Protein Info for Ac3H11_1160 in Acidovorax sp. GW101-3H11

Annotation: probable two-component system response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF00072: Response_reg" amino acids 3 to 116 (114 residues), 76.4 bits, see alignment E=1.9e-25 PF00486: Trans_reg_C" amino acids 149 to 219 (71 residues), 60.6 bits, see alignment E=1.3e-20

Best Hits

Swiss-Prot: 49% identical to RSSB_SERMA: Swarming motility regulation protein RssB (rssB) from Serratia marcescens

KEGG orthology group: None (inferred from 63% identity to cvi:CV_0593)

Predicted SEED Role

"probable two-component system response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JAF7 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Ac3H11_1160 probable two-component system response regulator (Acidovorax sp. GW101-3H11)
MHILLIEDDLDLGRALQSALKVEGLTSEWLRRAVDAPATVDATTVDCVLLDLTLPDGSGF
DLLARWRNQAGQGGQVPIIVITARSAVEDRLAGLDGGADDFVIKPFATAELLSRIRAVLR
RSARQASERWVLGELVIEPRRHAVQRDGAALELSPREFQLLLELAREPGVVVSKSLLSQR
LDPLGEPVDFGAIEVHVSNLRRKIGAELIRTVRGVGYLLQA