Protein Info for Ac3H11_1143 in Acidovorax sp. GW101-3H11

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 837 PF12860: PAS_7" amino acids 157 to 273 (117 residues), 65.3 bits, see alignment E=1.4e-21 TIGR00229: PAS domain S-box protein" amino acids 277 to 401 (125 residues), 48.6 bits, see alignment E=8.4e-17 PF08448: PAS_4" amino acids 297 to 397 (101 residues), 28.9 bits, see alignment E=3e-10 PF13426: PAS_9" amino acids 344 to 394 (51 residues), 26.5 bits, see alignment 1.6e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 402 to 570 (169 residues), 146.2 bits, see alignment E=7.5e-47 PF00990: GGDEF" amino acids 406 to 567 (162 residues), 158.6 bits, see alignment E=2.9e-50 PF00563: EAL" amino acids 588 to 823 (236 residues), 262.5 bits, see alignment E=8.3e-82

Best Hits

KEGG orthology group: None (inferred from 80% identity to vei:Veis_1344)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165J941 at UniProt or InterPro

Protein Sequence (837 amino acids)

>Ac3H11_1143 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Acidovorax sp. GW101-3H11)
MTSVGVLWVDIDTQHAAAARRLIAERYPDWRVVNSPTPETAMAPLASQAWDAVVMCLRPS
EQELPGLLELCAGRPVLMCIDATQEALAARAFRCGLGDYVLREPDDVSHLSELLNRLVAL
TQGAKGQGQPVRMVDARIWQEALTMLQEQRTALQATLASMSQGIFKTGPDGRITVYNQRV
LELLNLPESLMAMRPTLADLTRVQAERGDFGAGYSLVDRRGHDYVAQGAVSTAPALYWRT
TRDGRTFEVRTTTLADGSLVRTFADVSDYVRVENELRESEARFRSLSDLSSDWYWEHDAE
GRFVQLAGDLSVNGIPLSSVMGRTRWEIGALNMTEADWAAHRAVLAAHQPFRDLELQRQR
ADGSMHWISVSGVPVFEANGALRGYRGVGRDITERKQVESQIERLAFYDSLTGLPNRRLL
VDRLQHATLAVARSDSQGALLFIDLDNFKDLNDTLGHDTGDQLLLQVAQRLKACVRESDT
VARFGGDEFVVLVEGLSPDADHASAEAALVASHIATTLGKPYVLGDASHHSSPSIGIALF
GQQPLSVDELLKHADLAMYQAKAAGRNTQRFFDPDMQAAVSNRSALEADLRRGLQEKELV
LYYQPVVDGKGRLQGAEALVRWRHPRRGMVSPAEFIPLAEQTGLILPLGHWVMQAACAQL
VAWSRSSLTRQFFLSVNVSVRQFRQPDFVEQVLGALDATGANPERLKLELTESLLLADVE
DIIARMEHLRRYGVGFSLDDFGTGYSSLSYLKRLPLDQLKIDQSFVRDLQTDPNDAAIVR
TILALADSLDLGVVAEGVETTGQLEFLQRYGCKAFQGYLFGRPMPPEVLERALRPAL