Protein Info for Ac3H11_1129 in Acidovorax sp. GW101-3H11

Annotation: Nitrous oxide reductase maturation protein NosF (ATPase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF00005: ABC_tran" amino acids 32 to 172 (141 residues), 116 bits, see alignment E=2.1e-37 PF13304: AAA_21" amino acids 136 to 204 (69 residues), 44.6 bits, see alignment E=1.9e-15

Best Hits

KEGG orthology group: K01990, ABC-2 type transport system ATP-binding protein (inferred from 75% identity to ajs:Ajs_1136)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosF (ATPase)" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JAQ6 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Ac3H11_1129 Nitrous oxide reductase maturation protein NosF (ATPase) (Acidovorax sp. GW101-3H11)
VTRNPPPIDLRADPAIEVLGAHKHYGAHHAVDGIDLRIERGEILGLIGHNGAGKSTLFKM
ILGLTPATSGEIRVGGTSVSGRDFRTARRHLGYLPENVVLYDNLSGLETLRFFARLKAAP
LAQCAALLDQVGLASAGNRPVREYSKGMRQRLGFAQALLGSPQVLLLDEPTNGLDPQAIR
DFYATLRRLQAQGVTIVITSHILAELQERVDRLAILASGRLQALGSVQALRERTHMPLAI
DLVLAPADVPAAQQAVARLLGITPLPTPEGLRLTCPRELKVATLAALAPLGTRLADVQIH
EPSLEDVYFGLREL