Protein Info for Ac3H11_1097 in Acidovorax sp. GW101-3H11

Annotation: Transthyretin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00576: Transthyretin
  • amino acids 3 to 115 (113 residues), 128.8 bits, E=6.4e-42
• TIGR02962: hydroxyisourate hydrolase
  • amino acids 3 to 116 (114 residues), 129.2 bits, E=4.5e-42

Best Hits

Swiss-Prot: 57% identical to HIUH_PSEAE: 5-hydroxyisourate hydrolase (PA1518) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 91% identity to del:DelCs14_4563)

Predicted SEED Role

"Transthyretin family protein"

MetaCyc Pathways

• ureide biosynthesis (5/7 steps found)
• urate conversion to allantoin I (2/3 steps found)
• urate conversion to allantoin II (1/3 steps found)
• urate conversion to allantoin III (1/3 steps found)
• superpathway of purines degradation in plants (9/18 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.17

Sequence Analysis Tools

See A0A165J676 at UniProt or InterPro

Protein Sequence (116 amino acids)

>Ac3H11_1097 Transthyretin family protein (Acidovorax sp. GW101-3H11)
MGLSTHVLDTMNGCPAAGMEVALYATDGDNATLIKRLVLNHDGRTDAPLFDNTSLRTGTY
RLRFDVAGYFKARGVQLPEPNFLNQVSLDFGIAHADQHYHVPLLVSPWSYSTYRGS